PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005576-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 461aa    MW: 50521.4 Da    PI: 9.2256
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005576-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.81.9e-32188244360
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    DgynWrKYGqK+vkgse+prsYY+Ct+++C vkkkvers  d+++ e++Y+geHnh+k
  NNU_005576-RA 188 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCAVKKKVERSF-DGQIAEVVYKGEHNHPK 244
                    9***************************************.***************85 PP

2WRKY103.21.5e-32380437259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     Dg++WrKYGqK+vkg+++prsYYrCts +C+++k ver+++dpk++++tYeg+Hnh 
  NNU_005576-RA 380 GDGFRWRKYGQKVVKGNPYPRSYYRCTSLKCNARKYVERASDDPKAFITTYEGKHNHA 437
                    5********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.6E-29174245IPR003657WRKY domain
SuperFamilySSF1182905.89E-26184245IPR003657WRKY domain
SMARTSM007742.9E-36186244IPR003657WRKY domain
PfamPF031064.4E-25188243IPR003657WRKY domain
PROSITE profilePS5081124.053188245IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.0E-33365439IPR003657WRKY domain
SuperFamilySSF1182902.22E-28373439IPR003657WRKY domain
PROSITE profilePS5081134.521374439IPR003657WRKY domain
SMARTSM007747.0E-39379438IPR003657WRKY domain
PfamPF031065.2E-26381436IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MEVKDPERMV IAKPVASRPS CSSFRSFSEL LAGAINASPP GAYTETVVAA IRPKTVRFKP  60
VANHDPDGMI SSQGEISGTA AYSSEKVSKP DCKSTVVYKP LAKFVSRRTA SLLANLGNFG  120
ISHQQTLVQH GDKTKQPSQN HLTSNPNGKL PPELEKQIIE PSKMATQSLE ECQRAVPATT  180
SGDRPSYDGY NWRKYGQKQV KGSEYPRSYY KCTHPNCAVK KKVERSFDGQ IAEVVYKGEH  240
NHPKPQPPKG HSSGAQGKEF VSDGIGQDTS YHYTHNERTG GSEERVENQN QVGFPVHLTC  300
PGKSITTCDP GNSGHETPDN SCGLSGGCEE GSKGMGAVDN ELRCKRRKTE SQSNEVGISR  360
GSAQDPHVLV QNSTDSDILG DGFRWRKYGQ KVVKGNPYPR SYYRCTSLKC NARKYVERAS  420
DDPKAFITTY EGKHNHAMPI TRNLNSAVSD LDLLPSTNKK P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-31188439877Probable WRKY transcription factor 4
2lex_A7e-31188439877Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010253452.10.0PREDICTED: WRKY transcription factor 44-like isoform X1
RefseqXP_010253453.10.0PREDICTED: WRKY transcription factor 44-like isoform X1
RefseqXP_010253454.10.0PREDICTED: WRKY transcription factor 44-like isoform X1
RefseqXP_010253455.10.0PREDICTED: WRKY transcription factor 44-like isoform X1
TrEMBLF6HQV70.0F6HQV7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0040g03070.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-98WRKY family protein